JUSTICES. 13 GEO. VI. No. 30, 1949. Justices Acts Amendment Act. 119 JUSTICES. An Act to Amend " The Justices Acts, 1886 to 13 : #. 0 : io. 1 . 1948, '' in ·certain particulars. ' 7:l{;:: ACT 01. ' 1949. r AssENTED To 22No APRIL, 1949. 1 B lativEe AbitysseeanmnadcbtlweydiotbfhyQtthuheeeeanKdsvilnaicnged' saiMnndPoscatornElisxaemcnetellnoetfnattshMseemaLjbeeglsetidys , , and by the authority of the same, as follows :- w Am ith en 1* d . " m T Te h nh i te s JA A uc c st t ti m cofe a s y A 19 c b t 4e s 9 , ", 1c8it8ea6dn t d o a1ss9h4a " 8l, l T " h hb e eere J ri u ena s r t de ic f e ea s rsre A do c nt t e s o S: ! h!orttrutcittlieon. as the Principal Act. -citedTahse" P T ri h n e ci .T p u a s l ti . ce c s t A an ct d s, t1h8is86Atcot 1m94a9y". collectively be ... tive Amendments of the Principal Act. repea2li.ngSetchtieondeffoiunirtioofnth" eOPrrdienrc"ipaalnAdcbtyis inamseerntidnegd tbhye . O se. .dment following definition in lieu of that repealed definition, name"ly" :- Ordgerra" nt-, oIrncrleufduessal oafnayny oarpdpelri, catiaodnj, udaincdataiolsno, 0rder. bbanyyyjjuudssetttiiceceremss oionrraataijojunusstoticifceewt, hoaanhtdesoaaervlaseonrdakndiynetderremmfuaisndaeel manaydecotmoptlahienmt oorrtohiemnte: rtTahine atneyrmapdpoliecsatnioont iocnoffcmelnumcdeiet, ti. • noagrnaypdeisromsrodinsesrfinorgtmriaaadlefcohr abarnygeindjouicfsttaibcaelnes indictable offence, or granting or refusing to grant bail ;" . ib"nyasecrr3treiipnmegSea, e" licinn. tgionlitenhuieneowtfeoesrnudcoshf " thrteerpePeaarslioenndc, ipwafelolrAodncsyt, " itshaeamnwednodrbdeyds o A f m s e . n 1 d 9• ment * 50 V. No. 17 and amending Acts.
120 JUSTICES. Justices Acts Amendment Act. 13 GEO. VI. No. 30, aaPSPDRs. epnoeiess2ptwd p stt2o e iryeno. ii a rncenlwtttssoo, f& c. rttheopetreiea" m4olefe. [ ( , d 2 abS) n 2 yeaa . ] cAmnPtod ( ipfer 1 opoln . yP ) tcohlei: aTn- tetmttwhyfeaedotnSGliilstoeotoynswrv-s- iteiciwonrtnnsgosofrs;ooerifcnttiChtohoeneupnisucPirlripnimonssceaeirypstaefodlrfo, AmiCncottulimiretiuess (b) AoataaibnnfnmoydyCleiossdhuhuiesc, rrtthsresuiadcboftitdsfetiwrrvPihibecdittecetsh,yaooprhSrpaepoassailsntrbietoteersnedsnto, hffeooosrrrubtcomahhumeandyapdilsaugatrrartipmiecoasatsnsoteyesf; ( c) Isfuccohnsdidisetrreicdt daensdiravbalreyasasnigynsaucnhamnaemteo. any time ( 2 b . y ) PTrhoeclaGmovateironnorapipnoiCntoupnlcaiclesmfaoyr hforoldmingtiCmoeurttos odiahffiaspstPnlrabeeicccteeteteysnfasaonSorrderyshscsohiamloadnnoliclsnreegalw. ttCiphtaohlenauiycnaretpstsspiumooctfihhenaPthdnmeeitsrettoenyrantifceStoteesfrswsraibietnoeshnypisane. ppclptatiovhcieeenltywesdhaamincadhes mwwatitmhhaoioyecn ( hhed 3 aai . ophs ) srcpebhTomieaihsneorengtrsoee. oGasrtanuohpymvcepheaoprdypnieunloratatsriectoedensai" snno.atyfnoCdhtoibimuasenneoyccfhiflliceecrlreemkeraakaoftytofeefrpvfprebeoetretmtytyaypptsslpiaeemosscisseeniiootfenntodorss Aofmse. n2d5m. ent aelixmeeuecnu5odtf. ieodSsnueccobhtryiocrnoermpepetmawealieetlndmintegywn- fotitrvhtdehese, rowetfohonertd" hsweaon" rPddasrnbiny" ycitiphwnaesalrererrotAainnncgtta, nioiynsf warrant of execution or of commitment" . oAfmse. n3d9m( le) n. ts nine 6o. f tPhaeraPgrrianpchip ( a b l ) Aofctsuibs saemcteionndeodn-e of section thirty- ainnldie ( u a) ofBthyarterpeepaelianlegdthweorwdo, rtdhe" wcloerrdks"" acnodurbtyorincsleerrtkin"g, ; ( b) By repealing the words " any offence punisp. able by the Court of Petty Sessions on summary conviction " wawnoadryd" bs y" iannsyertpinrogc, eeindinligeuunodferthtohsies rAepcteailnedawsourmdsm, athrye
JUSTICES. 121 1949. Justices Acts Amendment Act. b su y chre7pr. eeapSlieenacgtleiotdhnewfwoorortdryd, " otfhfievthee" woPardnridn" cbiyptwailnensAetrcytt- ifniivgs, e" ainm; leienuadnebddf : ;n s e . .1;11ents ainlssoerbtiyngreinpelaieliungofthsuercehinretpheealwedorwdsor" dssetvheenwdoarydss"" tawndo months" . and 8th. eSefcotliloonwfinorgtys-eecigtihotnofistheinPserrintecdipailnAcliteuis rtehpeeraeloefd, R ' :. e 1 r 4t a e l w of namely:- ooocobrrmjiwenpc " atflraio [ ori 4 rannm 8 nti . ts ] oottrIaroffkoaaeirftnpaptfonhrobyeerjhaesencuhntcaedihoallnreaaignlldeigesdegfdeetodenaffdkdeaeceannftnettcyhftieosirrsnceuoieaanmdnnipynyulsaspuivuonbamntsrtmiasaaunonncncchyees . Wc& : oc : ma r . :U np 1: tl : a ! oi e fnt in , between the complaint summons or warrant and the evidence adduced at the hearing in support thereof the justices shall make such order for the amendment of the bcoemdpeslairianbtlesuomr mtoonbse noercewsasarrraynitn atsheapinpteearressttsoofthjuemsticteo. j b wuyosrtrdiec9spe, . estaSht 1 omee . cwbgtieoto" r h ndefsawo" nrodtiryn d b- nmsyi'na , inkeasinoenyfrgttsiahnunege, h oPrirvndianelrrcii . eiafpuonarcoletAfh· acesputpacimsehaaerr: nesindpetmeonadtel h eenddet Aofmse. r4r< 9lm. ent, ; of a complaint summons or warrant the justices consider ttohhraeitfctoihtmeapdpleapfieneantrdssauntmot mhthaosenmsbeoterhnawmtaitrshrleaednvtbayhriatashnecbeefeobnrmetmwinaedewnehotihcuhet caotmtphleainhteasurimngmoinns sourpwpaorrrtantht earnedofthies" ev;ideanncde aadlsdoucbeyd rreecpoeganliinzgantchee'r' eianndtheinswerotridnsg " inorlieduiscohfarsguechhirmepeuaploend chwthoiosnerddwdistioistorchdnheseadwr" g" oeor;drusiap" fnotdonhreahilfdsisotehfebeennyddteeaafrndeitnnddgiinsagninnttotioots itinnhaeccurusesascttioodogddnysyiezocamrtndiaoceyner esunftfeerr ihntimo atoregcoogantizalanrcgee cbountditmioanyedalasos arfeoqrueisraeidh" im. to bliyeure1op0fea. sliSunecgchttihorenepwfeiafotlryedd" ofwvtoahrrdeia, nPcrteihn" ecipawnaoldrAdbscyt" iinscsoeamrmtipnelngad, ineitdn, ° A; nse. .ment summons, or warrant" . by re1pe1a. liSnegctthioenwfiofrtdys- t"wsoixofmthoentPhrsi"nciapnadlAbyctiinssearmtienngd, eind A or m s e . n 5 d 2 m · ent lieu of such repealed words, the words "one year" .
122 JUSTICES. J1tStices Acts Amendment Act. 13 GEO. VI. No. 30, oAfmse. n8d4m· ent. word1s 2a. ndInbrsaeccktieotns e"ig( ohrtys-ufocuhrloonfgtehre pPerriinocdipaasl Amcatythbee consented to by the defendant) " are inserted after the words " eight clear days " . oAfmse. n8d8·ments amen1d3ed. Sbecytiornepeeaiglihntgy- etihgeht woofrdtshe" PmrainycipsaulffeAr ctthies defendant to go at large, or may commit him, or " and by inserting, in lieu of such repealed words, the words " may commit him or if the defendant is in custody " ; and also by adding to the said section the words " or if the defendant is not in custody may suffer him to go at large but may also require him to enter into a recognizance conditioned as afor.said " . oAfmse. n9d3m· ent amen1d4ed. Sbeyctrieopneanliinngettyh- ethwreoerdsof" atthethPe rtinimciepaalndApctlacies mentioned in the recognizance " and by inserting, in lieu of those repealed words, the words " at any time and place for his appearance at which the recognizance is conditioned or which is mentioned in the recognizance " . New s. 94A. 1 5. The following section, numbered 94A, is inserted after section ninety- four of the Principal Act, namely : - Noacfocsneup rteatniecse. " [ 94A. ] No person shall be accepted as a surety if it appears on the administering of an oath to such person that it would be ' ruinous or injurious to such person or his family should the recognizance be forfeited for any non- compliance with any of the conditions therein. " oAfmse. n 9 d 7 m . ent the w1 o6r.dIsn" soerctitoon snomineetyo-tsheevrengaoofl tohre pPlaricneciopfal leAgcatl detention which is more accessible or convenient " are inserted after the words " mentioned in the warrant " . Aofmse. n9d8m. ent amen1d7ed. Sbeyctiaonddinnignettyhe- eriegthot tohfe tfhoelloPwriningcippaalraAgrcatphis, namely : - by O"rdTehreinGoCvoeurnncoirl pinubCliosuhnecdilinmtahye f G ro a m zett t e imame etnodtitmhee said Schedule by altering or deleting any of the forms therein contained or by adding to the Schedule any other forms (whether in addition to or in substitution for any forms in the Schedule) , and the said Schedule as so amended shall thereupon become for the time being the Third Schedule to this Act and shall have effect accordingly.
1949. JUSTICES. Justices Acts Amendment Act. 123 Awcotrdt1sh8tew. wiIconersdaepscp" teioaanrg. oainnesthuynodur"edaarnedrfeopueraolefdthwehPerriencsiupcahl oAfmse. n 1 d 0 m 4· ents Astuhcretetw1yios9rod.arm" Ssueebcrnetaditioeilen" ds" , obntyhe; eharuwnenpdoderaardellssidno" gabnwytdihtifhenifstoewerreotniwrndoigtsfhtt" ohhueewtrePiatirnhi, snucasriufpetcteahyrl Aofm s e . n 1 d 1 m 5· ents or sureties" . tPhreinac2bip0sea.nl cSAeeccottfiotinhs eaodmneefenendhdeuadnndtbr" yedarnedpaenbadylininfgosrettrhytei- ntwgw, ooirndolsfie" uthionef ° . s e . ..ent such repealed words, the words " as fully and effectually to all intents and purposes as if the defendant had personally appeared before them in obedience to the said summons ' ' . Act i2s 1a. mSenecdteidon- one hundred and fifty of the Principal oAfm s e . n 1 d 5 m 0· ents and ( a) By repealing the words " against a defendant" ; owarnoddredr ( bs b iy" ) s mBiunypasodernreet" pitneh; gae, laipninnegdrstloiheneuewoonofrvdtichsto" esdeuoprreopnaegatahlienedsdtwewfoehrndodsma, nttthh" ee ltahset a· ( w c po ) preBdayr"sinimnseitnrhtuientegs"atihdewsewhceotrrieodnss. " ucohr mlaesmtmoreanntidounmed" wafotredr by reTpheealminagrgthineawl onrodtse" toontdheefesnaiddanstec"t. ion is amended : . Uf iPnrsienrct2iep2da. liSnAeccltiteiouisntrheopenreeeaolfe, hdunanandmdreedltyhe:a- . nfodlloswixintgy- osencetioonfs tahree : s. ir1 66 : . 1 ! . . ; r " Enforcement of decisions. poderacyicmso [ i 1 oest 6 nns 1 ti . s ] oafnmWdaahdpweeenhndeaoa. nlnetsyytnhodoeretccAeiosxcmipotrpnebesnaysdslyajvutpi1. dr0rtgnoueveosidrooesrf- urmweqhouifcihrmesosnutechhye . eewMnxhofpe J dorrr : e.e , c8o 1 : en ° ' fmo n ent (a) Tactshuoonamcdbthpeceplhnteaahvsytaeimteteideolnsanbtmy, ooofodruritnsshbttureymeseposxefoaerfsncoudsmnutioscoanhlnileaey;bopleofoerrntthaoceltoygsmotsaokdoierss
124 JUSTICES. Justices Acts Amendment Act. 13 Goo. VI. No; ' 30, ( b) That such person in default of payment of such penalty or compensation or sum of money or costs either immediately or within a time to be fixed by the adjudicating justices is to be imprisoned for any period not exceeding the period stated in such Act, then the adjudicating justices shall in their discretion either direct that the amount of such penalty or compensation or sum of money or costs shall be recover able by execution against the goods and chattels of the person liable to make such payment or in the alternative direct that in default of payment of such penalty or compensation or sum of money or costs either immediately or within a time to be fixed by them such person shall be imprisoned for any period not exceeding the period stated in this Act or in the Act by virtue of which such decision is made. Execution. lp, Mmceoevoosnyntdasieel. nytogisef, s, or rcdeoiqsmcurpi [ ere 1 ten 6 ido 1 sna A tto . i ] dobniWreehpocrtaenidstuhutmahntedoetrfhaedamjudaodenmciecioysauitonionntrgsohcfoajusllttshstbieecaerdpsejeucnoidnavgleterytdahbeoolierrr by execution and also when the Act by virtue of which a decision adjudging or requiring the payment of a penalty or compensation or sum of money or costs is made expressly provides that the amount of such penalty or compensation or sum of money or costs is to be levied by distress or execution, then the amount of such penalty or compensation or sum of money or costs shall be recoverable by execution against the goods and chattels of the person liable to make such payment and a warrant of execution may be issued for the purpose of levying the same. " oAfmse. n1d6m2·ents Princ2ip3a.l SAeccttioisn amoneendhedunbdyrerdepaenaldingsixthtye- twwoordsof" tthhee defendant " where such words first appear and inserting, in lieu of such repealed words, the words " the person against whom such warrant of execution is issued " ; and also by repealing therein the words " the defendant" where such words thereafter appear and inserting, in lieu of such repealed words, in every such case the words " such person " .
1949. JUSTICES. Justices Acts Amendment Act. 125 " lhieuPunodtMwhreeeodrrreetoaoofnv. ddeertstaixhinteyum- tnwatriolgirinseatrulernpnoeotaelfewdtoaartnrhadenats" amidiasrsigencisnteiaroltnendoonitnee idPnersfieenrnct2diip4naagn. l, tSA" ienccttlwiieoihusneaoromefnesesunucdhchehudrnedbwpryeoeardrldeesdpaenwfadoilrisrntdsgisx, attthpyhep- etehwawrroeorerdadsnosfd"" tttbhhhyeee Aofmse. n1d6m3.ents person against whom such warrant of execution is dicisnaesssfueeeerntdtdi" hnaegn; , wt" aionnrddwliseah" ulesrosoeufbcsyhsuucrpchehepreswroaeonlpirn"edag. sletdthheewrreoeinradftste, hrienawepovpreedrasyr" sautnchdhe nihnoutnleideM" rueodCtrhoeeomarvnemedorift. tsmhixeetnymt- tainhrgrdeineeafaliusnltorteoepfeteaoxleetdchuetaisnoandid"aseiscmtiinaosrnegriotnenadel by re2p5ea. liSnegcttihoen w1o6r3dAs o"f dtehceisiPorninacdipjuadl gAesctthise apmayemndeendt . O se. ..· A e . nts of a pecuniary penalty or compensation or sum of money oofr mcoosntse,yoorrwchoesnts," anaonrddeirnsreerqtuinirge,sinthleieupaoyfmsuencht oref paesaulemd words, the words "decision adjudges or requires the payment of a penalty or compensation or sum of money " ororcoosrtdser' ' " ; wahnedreasluscohbwyorrdesptehaelirnegafttehrertewinicetahpepewaorr. ds " asPunrccdionhncb2cviyp6aicasi. tenlisSsoeAentrchtctoeitinorwgnio, osrirodndnea" lermie" eduhnewuodcnifhesddeisorrueencbd" hsyu.racenhrpedepwaelsoeaixrdlidtnwsyg- tofwrotduihcsree, ioanwfpbpotorehdtahesr Aofmse. u1d6r4n. ents " tPhrceionpnc2avipy7icam. tlieSonAentccototirfooanirssduoemnraemfooferhnmaudonepnddeernyeabdlotyryaconorresdtpcs" eosamialxipnnteydgn- bfsaytivhteiienosnoewfortroitrnfhdogesr, Aofmse. n1d6m5· ents aindjulideguinogf osrucrhequreiprienagledthewopradysm, tehnet woforads p"endaeltcyisioonr compensation or sum of money or costs" ; and also by wrehpeeraelvinegr suthcehrewinordtshethewreoarfdtser"apcpoenavricatniodnbyorinsoerrdteinr"g, in lieu of such repealed words, in every such case the word " decision" ; and also by repealing therein the words
126 JUSTICES. Justices Acts Amendment Act. 13 GEO. VI. No. 30, " the defendant " where such words first appear and by inserting, in lieu of such repealed words, the words " the person liable to make such payment " ; and also by repealing therein the words " the defendant " wherever such words thereafter appear and by inserting, in lieu of such repealed words, in every such case the words " such person " . oAfmSe. n1d6m6Ae.nt " or 2or8d. erIn" asercetrioenpe 1 a 6 le 6 d A . of the Principal Act the words Aofmse. n 1 d 6 m 7· ents Princ2ip9a.l ASeccttiisonamoennedehdubnydrreepdeaalinndg tshixetwyo- sredvse"npeonfaltthye, or sum, " and by inserting, in lieu of such repealed words, the words " penalty or compensation or sum of money " ; and also by repealing therein the words " the defendant " and by inserting, in lieu of such repealed words, the words " such person " . Moreover the marginal note to the said section one hundred and sixty-seven is amended by repealing the words " of defendant " ; and also the head note to the said section is amended by repealing the word " execution " and by inserting, in lieu of such repealed word, the word " imprisonment " . sAno. fomtm 1 ee 6 snt 8 rdo . gmineanlt tshixetyw3- eo0irg. dhsTt h" oefoftmhdaeerfgPeirnnidanlacinnptoa" tleAatncotdsiesbcyatimoinnenseodrnetedinhbgu, ynirdnerpeliedeaulainnodgf such repealed words, the words " on payment " . oAfmse. n 1 d 7 m 4. ents Princ3ip1a.l SeAcctitonisonaemheunnddedredbyandrepseevaelinntgy- ftohuer owfotrhdes " adjudged to be paid by a conviction or order " and by inserting, in lieu of such repealed words, the words " adjudged or required to be paid by a decision " ; and also by repealing therein the words " to be paid (including costs as ascertained by the conviction, or order, or order of dismissal) " and by inserting, in lieu of such repealed words, the words " or required to be paid (including costs as ascertained by the decision) " ; and also by repealing therein the words " conviction or order " wherever such words thereafter appear and by inserting, in lieu of such repealed words, in every such case the word " decision " ; and also by repealing therein the words " or order " wherever such words appear after the word " decision " .
1949. J USTICES. Justices Acts Amendment Act. 127 tinhseerP3tre2idn.caiTpfthaeelrAsfceotc, ltloinowanminoegnlye· : s- hecutniodnre, d naunmdbseerveednty1- 7f4oAu, r oisf New s. 174A. fccroeohrqmaurpgni" reeoen[ dnd1s- 7a W pt4t I a· oiAtoyh. ] nmbteWehonerphtaeesixnoudefmacbutpytohe1. fer0asnomadnomoefntcoaeieusnyfwndotneaorrrsrotahtfcnoeotaststnohusyfemcapodpommjeluincmedaengl1· totteiymfdofineceonoedrrtr w 0 : t tP U o e 0 : a o n Xr l U : e d i r n cx e U a n e r e n t o e c . o tt u d f o t . f e ie f c n e t r in such warrant together with the amount of the costs . oafnfdicecrhsahrgaells a(cifceapnty)thtehseureminsaolstoenmdeernetdio. ned such police tatteeohxlsneeotdchueaImertfmeeedtdonhiruttetehinoocestntuhiemowoidmnfasmirtshrtheaehpenneasttrihicedooabbnsltuyletostdegxsiiaiuvenfncceduhsnput. " apeccrhohtslauiwocrcegnaherloyrswfafani(ocirtfferratsaonhungtecyea)htschhcestaoruhlrmelwdrnieintoiihngst aPrreinicn3isp3ear. lteSAdeccitntiolniiesuorntehepeerhaeuloenfd, drnaeandmdealnythd: e- sefvolelnowtyi- nfigveseocftiothnes : n R . n e e f w p 7 e . s a . e l : 1i o _ 7d f 5A. orl_ ieraqbsuulei" mret[ s1oo7ftm5hm. ae] oknpe[ 1easy • ) yumcohWrencphtoaesyontfms aeaannnndtyydiptoeeadnspeapcnltieosyaitorsnroertshicdaaoedtmJ"tauphtdeegonpersseanrtsieoooannrr J a : ' ! 1 ' s : I r r . t ! l o 8 . d e ! i % n c e f t r 0 o 1 _ o • 0 r n r ce- the place where such decision was made the clerk · of cpafoocerntttvohyeronsladeiecsintsnsitgolfynoCsrboauethtrptesesurefconohffrompPrcleeaetdcmteyaemtnSstaeosyomsfiioefsnuohsctehhpcerdoreenppcsailisardiecoeernasancptdahpnaostiimgnantonerydae certificate in duplicate called a " transfer of fine certificate" and transmit to the clerk of petty sessions at such other place such transfer of fine certificate and the duplicate thereof together with the minute or memorandum of the decision aforesaid and a copy of such minute or memorandum if a copy of such minute or memorandum has not theretofore been served on the person liable to make such payment. ssstSeoureasmcssnhsieiso( om2ndno. ) seitsthcttWiseeosurdiohcwpnhetlhhraeocacclamteietnraaakanppmypoptoorfearaiacenpnrttessecftodaoetrrtnyfvaaooscenfretnyssfhisietnoifnoiolemtdnrliscyentehgtmrboetCiaefaeyioncpcuafplerteortrerrfsekcopheoromaamffrseeePpndbeeatettnettaodynytf
128 JUSTICES. Justices Acts Amendment Act. 13 GEo. VI. No. 30, paaasswspweiunnnelgiaracttdddnsvchhteeyamtsatdrmhhsscaauafeeiondonulcsplsmensrhumyitttotihcnheihntoteeuehesfrrorttetresteaoituruftroipimcptacprehthanolehrmietnsmcsmeefoaeceotimntparlnrreenlaaruoaodoknlnrtciffaesdaetmonbufshoifwdulmineretucphemhdmeefhtutrocoecateropemeystrflrthimtotstchniwriefhaafoeiasiteciktcsnteadaiedhdottetteehuncehcts, eim. sioeusrsriaiceioneottihtnfohonsftfeauaaprotcfifrcacophooeolygrlrepiomeeerbcyttsskaeehhaatenoioeeiedndtrrff, ectapitonefarosfrbtrhotieeriaf( csci3lcpuale. ) aialbdattieerdEhs p aehvino r neas i fdrs m asty· iabhs a dtheet f iserad a mfnale c aln i cics e nsistisftugieieoaovntrntenieeddoooeafrtfnbnhmscfydeiuenectoetamhhhfceocetdtesrhceraalectienmififrsdfakioiaouccunnamtonytsfteatopnhpfssedetehttrirhtalweflyeloihlnrrdseemiseenqntsceucasisdliistuuorieoecdntdhdnoes. ( 4.) When a clerk of petty sessions receives a transfer ohtorffeafnhirnseaemcsecirietpertcttheifeiivecsneaaddtmeoserhusteceohdsthchaoeelnrlctfliefotirrhcktaehtowefd. iptuheptlstiiycgansteetshsiecoenmrsteifmfriocomartaewndhauonmmd odittppsrrfeleaaarcsnnfcfiiiseogssn( irmmn5oems. ) eniihttdceattAedeelwralddstanhit( ffdaicurictcnoonhhatmudlrteelaedsntipnsfhoalshaetmlalscadoueivfattaceuhtttcheroetetdbsrohwewafefeahitronssihrcectehh: eprterteahsrtrrnueiaeffsciniofncehrseanbmmrctfeeeeoifosdrrofstcrihieoeaffamiintcnpdaeoerstnfooecntvamehoitrodetartfeasidfonbi) sbtcsueehafecebeetnhnrere wsaphcehcateotlrlyuPenbrssteoeuevscdfsihoidofredontdrhescwbtibshyiytiaohttnvhtiaewrrnatacyunlseesrmpmkoaaifytdotmafee. deptnerbttatynrysefhcseeiermisvsoiefotdonfisbnayaentdactehsrchetleiafprliklclaabctoeeef ( dssshuuuaeimnmccchhliesea(is6opnspt. ) nadoeaygrhItmsefafrotuseahnarnnnetctshroomtethtpwrihbeytiettetreoehsadcnfalnetiaassdhrefskeretravrcmofeaooofdniprfnsyepouffsenetainrteoittedyfoh) ocrefecstmpreahftiesueenisrfmsiesoeicosonanactrstoieaedlrinrbatiedibsefcmuilecsesmiiaievngttriuonoevntefegmedsdshuatboakhconylhreel
JUSTICES. 129 1949. Justices Acts Amendment Act. memorandum together with a notice advising such person that such payment is to be made to the said clerk of petty sessions instead of to the clerk of petty sessions at the place where the decision was made. ( 7. ) Where such decision is enforced by virtue of a transfer of fine certificate the clerk of petty sessions at the place where such decision is so enforced shall report the result of such enforcement to the clerk of petty sessions at the place where such decision was made. rAeccteiv[ u1en7dd5Aebr. y] wSauhbiccljheercktthtoeof cpaoenmtytpyldaisirenestcstioiwonnass cuomnndatedarienaeadndyeincisstuiohmne ; Al . l . oca ! t n io ts n . shall be applied- ( a) In the first place, in the repayment to the complainant ( or in the case of an order of dismissal or other order in favour of the defendant, to the defendant) of any Court fees paid by him ; ( b) In the second place, in the payment of any Court fees which have been ordered to be paid and have not already been paid by the complainant or defendant as aforementioned ; ( c) In the third place, in the payment of any costs and charges of taking and conveying the person making payment to prison (if previously ascertained and stated in . the decision) ; ( d) In the fourth place, in payment or repayment of any witnesses' expenses payable under the decision ; (e) In the fifth place, in payment of any professional costs payable under the decision ; (J) In the sixth place, in payment of any other fees or costs payable under the decision ; ( g) In the seventh place, in payment of any compensation restitution or damages adjudged by the decision to be paid ; and ( h) In the eighth place, in payment of any sum directed by the decision to be paid and, subject to such direction, if any, in the manner in which fines, penalti.s, or forfeitures are to be duly appropriated. " E
1 130 PRanaedrpteaInlXewo. f JUSTICES. . Justices Acts Amendment Act. 13 GEo. VI. No. 30, - - - -------- - - -------------- ----- -- -----. two 3h4un. dPreadrt aInXd. noifnethteoPtrwinociphaulnAdrcetd ( baenidngfisfteyct- oionnes, both inclusive, thereof ) is hereby repealed and the tfholelroewoifn, gn. aPmaerlty : I-X. and sections are inserted ' in lieu rOervdiee:wr t. o " PART IX . -APPEALS FROM THE DECISIONS OF JUSTICES . Division ] . -Appea l by way of Order to Review. tmsenCicooobcJfwcs" iiw( nsnrhhhuoxaonrryoousahoeaeoanlmccuutdlrlnmeonrhetu, vaaerrjigfteprtemnuldwa [ ftiohediioudfdlc 2 gnssnooriatearoetpde 0 utfnarthodir" nriroido 9 onacdnfcehreeoohra . tfnhvaCoetedt ] retrtenafhnarifashharamtstoyuiae( bntjrmteanoac1r, upocitoayecbimtnoi. nrohrasapkarnd) setyrgteboslkopolieeghseliaipnw) vWniernfceephcvesjseegiredauaseroJhoiewnschtisesutrlswtwsoiiuhdrluiwerohth" asiasanoindeaniaucofg"lyeencnj p ntggnhrhceudetprt) haet r sadthster. ta" ne i u, mcusioacjeh m gorosayobcuu) ssro - ortderfarrhlroedy a ecsnraleidptaonhaiertcnvsc f jnieaoehefrfntcpuco a ( ittgsrmntiecoaeosnw c eososhwotyttnt i unrouvoneieSai e hridvoncddchrpirtjruaeciadheniciuweyharonirscptawseandsnieatiiorssjnritnsocttcihptsueeurioehotnttio" cmopsnemnhsp, ne( oretatblh) oderwesvofifiguemystcceoeoeriaapuehpeoaerecCvdrrjainnresonraeactltnuioerstdioithdnnrtorrsnonutojyteJyitaueorragrrys( - tdwogrdbasutrhedfhwoctojtgrlieeideaicbeursinsoegcrrhrcrgraoiryshniwttwmteoerjementteiotvtuaimovaiahlirnisiccnriafasnrcnsreeemhcaadetrwkttrosdrgtlaio, faaaatttiemaclitnwhhnenoeynkoooteiaeiynddnyneeegotssterrrrss, bbeeffoorr ( ee 2 . a ) thJSeuudScghueposrrietdmteirne gtCoionurCertvouiesriwtttoimnrgaCyahsbamethbmeearFsd. uellreCtuournrtaboler ( 3. ) Where an order to review has been made strCSwttihhoeuotiteattpruuhiterrnroivettnngrhmiadseessbweeiettolr,hvetrCsieedtneornboergeuervodrfrteftaaoeorsvoyaesrinspeiettpwvtaahthofiieetneiJtenwgouarFtpdebutabdpgehlseleeertletlComsaatheounnearburdtdvenrFieatacthubehnretlleeollohetdtneubiCrcerneoehrnsfouepoitatmsrrhobptenalloeeottdanshfehstdbeneteettSthnfrhhuoeetaderqpneeo, mursrfeiiitdtarmrreheeeysnseerts,
1949. . JUSTICES. Justices Acts Amendment A. ct. 131 days after . service of such notice and file with the Registrar of the Court an affidavit of the service of such notice, and the order to review shall thereupon be returnable before the Full Court instead of before a Judge to all intents and purposes as if such order to review had been made returnable before the Full Court in the first instance. ( 4. ) There shall be no appeal to the Full Court from any determination of a Judge but on the return of an order to review before a Judge the Judge may, if he thinks fit, refer the same for hearing and determination by the Full' Court. ( 5. ) No order to review any order by any justices or justice made on any complaint for any moneys recoverable summarily or on any complaint for any claim determinable summarily shall be granted unless the sum or (as the case may be) the amount, value, or damages in respect to which the person applying for the order to review is aggrieved exceeds or exceed five pounds (exclusive of costs) or unless it appears to the Judge that the order complained of ought to be reviewed on the ground that some important principle of law or justice is involved, or unless the said justices or justice had no jurisdiction to make such order or exceeded their or his jurisdiction in making such order and substantial j ustice has not been done. gCroaunr [ tt 2 io 1 tr 0 u . ] CphoOnanmatbnheyersgrretofouugsnardlanootrf gsauroJehuundodgrsedtewhrheteoatphrpeerlvici. seaitwnttinomgr atiyno rgtAeorpfarupnesetvaaolierJtfw d oreo. rm renew his application to the Full Court which shall have all the powers of the Judge provided that such application shall be renewed not later than the first day of the next ensuing Sittings of the Full Court or within such extended · time as that Court may allow. term [ s 2 t 1 h 1 e . ] gErovuenrydsourpdoenr twohricehviietwisshsoaulgl hsttattoe rienvisepwectihfiec ; er: a nt 0 9 d t • o conviction order or warrant. am. a. Jyu( [ dd2 2 gi. 1 r) e 2 e . cOs ] thn( ab1glul. r) tabsnEeutvcirnehergtytuaimrnonreoadrbmedlreaeyrtaottboersreueevnvcihelieawwrtgirmetedhteeubarJynsuaadtbnhglyeee. mJbJueaudfydog- greee. w R . b ! eh: r! gi. cur1rh' san a ni : tt _ . em f d a. y ( i. ) Impose such conditions as to costs and security as he may think fit ; and
132 JUSTICES. Justices Acts Amendment Act. 13 GEO. VI. No. 30, orJPCrereuootdvudwueirgreertewnrtso. ooornoff ( ii.) Mmanaadkyeftsohuricnhakdpmnreoictvetisisnsiagornya.fnoyr apesrtsaoyn otfopbroaciel eadsinhges ameauvdnpaiddoydnu- e [ cin 2 feca 1 ( dei 3 t. ) h . ace ] eoniDt( ndh1Cisse) . iobcdruhreOoorarturnaraggtoliehrorteonttrhbJueoberunffyodorgrdatoeeehfffretitdhhataoenienvvrskiieotadsvriedtdinfeheiwcjetrue sC; ottoofaicuneadrrsntevyomoirerafwjtuJuerusrtatidhiangcelderes ( ii.) Cqounafsirhmt, hevacroyn,viacmtioenn, d, orrdeescrinord,wasertranastid; e or ( iii). Isnacidreacosenvoircrteiodnucoer aonrydepre;nalty imposed by the ( iv.) Rroeerhmweiatirtihntohguettoacnathyseedsoiarriedctmjiouanstttieicnreslfaoowrr ; juhestairciengwitohr ( v.) Ostridpeerndthiaartytmheagciassteraotre m; atter be retried by a, ( vi.) ImtfhatehtteceaCrsoebueorrtreomhreaJattureddrgboeyrthoainrndoketsrhentrehcaJetussdtahgreey, ; craesheeaorr ( vii) . Ppoortrrohdoheecirrebeoidtprinewtrghsaeorinrnasanrifetdrso; pmjeucsttpiocrfeosctehoeedr isnjaugisdtioccreonofvurircttahinoeynr ( viii.) Aaniacnmaslelgscaesseernusebosdcarehjurofmyoarsrmtacefataoetnturnehysdrteemhduteseepoafnpoiedbtnucsetrjtspuoahhomrseasteleielmcrnreobdeosfererioddmtirsenoat; jdenaurnesmsytuaiisccpnhemrino; tagceyeartemnbhddees ( ix). MpmdorraeeotkrJeceiretumesd, daigilnnleagttssihuotinconhkobsfeotrnhhdeaeecdrecssaassnaeadrnyotdratkmoceaansutetasceesurrtueahplelaoCnsfoiutunchrahetl a c oet o hxnr r eed p rjC u icunio s rsuaie : sdrdtudipcoittoriinooJnnu c t e do r wg ti eah o n r imyc a ha r oy i th m tehex a ree n pr d coC a iwso m eue u rar s tlhlepoprrreooihsansniebbysietsfoieoofsrnethocoerornp h mfo a ewri b gr e eeh a rd s ts
JUSTICES. 133 1949. Justices Acts Amendment Act. jaoJiufrpudspidtteeigrcPleoelarrtmohnovhataiesdyrtoeehcvcdbeocieneuCtswrohiordfaueetdmrort. psingioonthrhtitowaJntiubthtndehsogtaedatsenumcadbinadisnyyetgadpdntiotihsiniacnahlttafmarrtavghisioeescueatdrCrhroeibouayfogrtredtthhooeeerrf jeCobCeuxnryoosefuutmrotirrcrch( ttaice2este.oseota) CrdeorbroWrJlaubewujhyrudaitJesngsrtutoeeihodcrtemrehgaJi. eegnajuiuyynldisinakgteclieexlcaayeescsmrsehcdcoaaieoosrlnareldrnlathajemnuanrwcvsyaeitaettisthpcweteohriaiwftebnhiemdyslriaktarwwhdeenihehhyseieofcbamfosheyrercdcdmtttteihhirboageeynnhmdctsattaabhhdbsideeeeee to co [ s 2 t 1 s 4 a . ] s Tithoer Choeudrteeomr sJujudsgte. may make such order as costs. Cjuosutric [ t 2 eos 1 r 5 o . J ] ru ( d 1 jug . ) estOmicneakthsehetaorllestuiufcrhnthCoeofruearuntnotoorrdJreuerdqtugoeirreaedvreibepwyor, ttthhinee J . u e s p ti _ c or e t s. by writing on such matter or matters bearing upon the mquaeystdioirnecotr. questions in issue as the said Court or Judge affida [ 2 v 1 it 6. s ] haUllpobne utsheed rbeytuarnnyopfaratny ourndleesrs-to review, no Affidavits. ( i.) SoteruoeifgctehuhtvtrhaneehfrfyooiCdfuoaorttvushhirebteterohfarpaodnasreedrbrtety; ahenteoocrftoitilpmheydeewptarhipotephcroeetieohndfetienRddgeeslfgiofvirosertrttrehyader- ( ii ) TipthueorrpCohoseuer. tthionrkJsufditggeruapnotsnsspuecchiatlelremavseiffoarntyhaast m.. istah [ pe 2 p 1 pe 7 ra . el ] sweInfittahanoty.iotnadptephleaelyrlaeonorft, imnanatkyakeosintdhgeefaranupylatnritenycepmsrsoaasyreycauspttpeinplygs ; D : i 1 s s m !c i 0 s J s t a i l o f n o . r to a Judge in Chambers by summons served on such tahpepeJlluadngtefosrhaanll omrdaekredissucchharogrindgerthaes osrhdaelrl tboerejvuisetwwainthd rceogsatsr.d to the subject- matter of the application and to
134 ,JUSTICES. J1istices Acts Amenclment Act. 13 GEO. VI. No. 30, tc.omrorasgn0ntvuorsidpmcdetrariitao. ntwnidn- g dsphrraaow1n1o [ n 2 bu 1 une 8 gpc . 1e· ] nod· rTtwnhooehtretut: ihmnPeerfrroftovohmried· aectpdohpnetlvhytiai1c·ntmtgiteo. hfneowroChraoenunorrotdtrhmedereariydstepofcooi. ssrr1t. emopvnaoielnlw1. yes its decision until the conviction or order is so drawn up and transmitted in due form. dMdueecmmisoioorf n a. n [ 219. ] Whenever a decision is given on an order to review the Registrar shall forthwith send to the proper clerk of petty sessions a memorandum of the decision of the Court or Judge and such memorandum shall be sufficient evidence of the decision for all purposes. JEo c fu o nd u dfo r ge t rce? 1. os.1r m on en o t f admeceisn [ id 2 o 2 end 0 o . , ] fvAtahnney . edCc, oounardvtJi • ucotdrigoJnedud, segin • emtiepnnocsreeedlaotriooronrmdteoardaenafybfiyromrdteheder ' to review may be enforced ( subject to any variation made therein) by any justices or justice (whether the justices or justice in respect of whose decision the order to review was granted or not) in the same way as if it had been adjudged, imposed or made by them or him, and any justices or justice may issue, make, adjudge or impose all such summonses, warrants, orders, convictions and sentences as may be necessary to carry into effect any directions contained in any decision of the Court or Judge given in relation to any order to review and no action or proceedings shall be taken against any justices or justice for enforcing any such conviction, sentence, or order notwithstanding any defect therein. thAwaoodo t bafeaphevaraypmeneepervodplelifordeaeina n gowtlehrot. ddtbesyr rfmrerigovahmni . etn [ w 2 weo 2 rfh, 1 aais . gc ] phhapaA1 • elnhlnaseblyt. eispatenabrkyyseonlnoartwwdoehehrnoatvoiaetfpleapdabenaatynlosdaobJ· UnpySpetdewi· acaaelnysiynoosfarunocyrJh· UdooSetttrrh· hnteeeorr, Division 11. -Appeal to a Judge of the Supreme Court. .smpgpleeaJl utotlgae. comp [ l 2 a 2 in 2. a ] n(t1, . ) dWefehnednanatn, yorpeortshoenrwfieseels byaggarnieyveodrdaers made by any justices or justice in a summary manner upon a complaint for an offence or breach of duty such person may appeal as hereinafter provided to a Judge of the Supreme Court whose determination shall be final between the parties to the appeal : Provided ·that in the case of a · defendant who feels aggrieved by a
1949. JUSTICES. Justices Acts Amendment Act. summary conviction of an offence or by an order made by justices on the breach of a statutory duty an appeal under this section shall not lie unless- ( a) The fine, penalty, or forfeiture exceeds the sum or value of five pounds or the imprison ment adjudged exceeds one month ; or (b) Such person has upon application made within seven days after the decision obtained the leave of a Judge to appeal under this section. ( 2. ) Every such appeal shall be made under and subject to the following rules and conditions : - ( i. ) The appellant shall- / (a) Within seven days after the decision or aafptpeera· lobatgaainininstg tthhee dleeacviseiono, f aas Jtuhdegecatsoe may be, serve on the person concerned in upholding such decision and on the clerk of petty sessions at the place where the decision was given a notice of appeal in the prescribed form setting forth the grounds of the appeal : provided that if the appellant is unable through no fault of his own to serve notice as aforesaid he may apply to a Judge for an order enlarging the time for service thereof and, if necessary, for an order for substituted service thereof, and such Judge may make such order or orders as he thinks fit ; ( b) After service of such notice on the other party and on the said clerk of petty sessions and within seven days of such service enter into a recognizance before a justice in such sum and with such sureties, if any, as the justice may require conditioned to appear on the hearing of the appeal and to abide the determination of the Judge thereon and to pay such costs as the Judge may order : or if the justice so permits the appellant may deposit with the said clerk of petty sessions such sum of money as the justice may direct by way of security in lieu of such recognizance but the amount of any such recognizance or sum of money shall in no case be less than twenty pounds ; 135
136 JUSTICES. Justices Acts Amendment Act. 13 GEo. VI. No. 30, (( ii. ) TabcoShofeuemfcpotosrphrpaeeleiymaditennochtolfCeetorditkcjuheuepreostoftossiapfaictteei- idtasotpnyntpsooesteaaitsnclhsediefootnoroRsttghheseewhgtrihaistleptlhrrroaonwrtcreiraoteenhfdcseimnttiphhgiteets (a) BCa C arpse o ipn u ssbuet r raa t canlh A eledt c , De t ifrif o rms f ottmsrh1iea8ctr9wpe5aloda"srcegef; tiinhvaoeeterdnNwbihoysirc * tnhh " oe T ttrh h nwe e i S Dtdh u eii p scnti r rs e tii m cohtne e , ( b ) RCoecnkthraalmDptiostnr, icitf ; suocrh place is within the ( c ) TNoowrnthsveirlnleD, iisftriscutc; h place is within the ( iii. ) TadthhneeecdisastiaopoipndtehatReelpneigsedirtssaotoyrnbas'reconhsnohectaaielrcrldenge; oidvf eitnhteoupdthhaoeyldaopinnpgwelshluaiccnhht ( iv. ) Iroiasufneurpntcdcplhopheeegerasansrralhaiepzsgacipahsornneaagdrlclpnleleahilnuzenooaantr( tinstl. ieio) cosledpiuognetfpoirhnrocateugnthgesitaitshhavopiseedspssusayeebel,scslnsautuaetancnrceyhittyrtiiyoonjsefnugemn, ecsttxueieainnerrcnitcstetdoiuyomtinntti; aohhetyndoee ( v. ) IvoubbucfofonnyestiddsddthuheeseercriaemohmntscahedcppecuiarpdstnasoieisdoctoleJleonenaceurtenhdtdidtwtaiognhvneotogieosbsamhwtanstuaanedoaniycyindtvsasiuoroneoertcdynadhdhnheepsaorrirhnsotophahrdrcaldieielmrgrenethbridypntteiatoenborongytfphusyraearletelpy; avsapahksiteenoaehawnndlell ( vi. ) Edtnetrhxxeoufcectaeeehnpsfpisdptnoiaveefwanetlhtphoseeehrrnpeacalileontlltahmalydiedepeesflduqoaonuilrenfdgaetuegti. retrilu, otturhyaenissdootshrreocefptaaicudopanmnpsiesewihtamthmleeiadesrynetthttbhhaeieest, * 59 V. No. 2 1 .
JUSTICES. 137 1949. Justices A cts . Amendment A. ct. ( 3. ) When by any Act a person summarily convicted or against whom an order is made by justices is entitled to appeal to a Judge of the Supreme Court a District Court or Court of Quarter Sessions, the appeal shall lie to a. Judge of the Supreme Court in the same manner as if it were an appeal pursuant to the provisions of this section. : ia:;. the a [ p 2 p 2 e 3 a . ] l s I h f atlhl ebeJbuydgweasyo oofrdreehrseaorrintghebuptarottiheesrswoisaegtrheee Appe._ to1be haaanpneapddrepic [ an 2 rolg 2 onsc 4 dhoe . ifa ] etlditlTohinnbhesgeeasahpbJsepeuaehfdraeodglrmeefaotnarmhdyesaudtyjhcuehitsneattkriticmmefasiiten. n. eyadndtuipmuopenontahdsejuoceuhvrintdeer , ntmhcees : . : a P. P g : d r . _ we: e s: e e scr d ..i ttoo r . b reyduh [ cis 2 e 2 o 5 trh . d ] eeUr cpcooonnnvfitirchmteio, hnqeauroairsndhge, rosfesatennaytse1a ' d npecp,eevaaolrrtyh,aemd . Jjucurddegiacesaemtiaooynr a P h J pe uo ap dw re ge ian er l s g o . nof appealed against or make such other order in the matter as he may think just and may by such order exercise any power which the justices might have exercised and such order shall have the like effect and may be enforced in the like manner as if it had been made by justices. to be [ 2 p 2 a 6 id . ] bTyheeitJhuerdgpearmtyayasmhaekmeasyucthhinokrdjeursta. s to costs Costs. Case [ 2 fo 2 r 7. t ] hTehoepJinuidogne omfatyhestFatuellinCothuretfoarnmy oqfuaestSipoencioarl !u a ' f: 8 ca m s a e. y questions of law arising upon the facts of the case and his judgment shall be affirmed amended altered or reversed and such order made as to costs as the Full Court upon the hearing of such Special Case shall direct. .:Fe:ted nantoofpoottpbaiieccen [ aee 2 yal 2 . moo 8 drfe . e ] InsafftdepNactepttohdeeemaawhlpeJehpnouemerttdahaigilesynerschatiaoamshpfleleaonsfbbsudtlebteahtdsthoteeeafemfnoeaseapcamnetimnetedioneoordmnafmcoetctferhohenerfaltdyotgrianmrbanogyndulyyirnn0edu1as1sapugsnoochohynntf a . A d b e 0 p! f lep i : : c . e. t anlinnf. o f c t o . r , such terms as to payment of costs to the other party or postponement of the hearing of the appeal to another day or both payment of costs and postponement as he may think just. .;.: i. prose [ c 2 u 2 t 9 i . n ] g ( 1 h . i ) s I a f ppaenayl waitphpoeulltandtelaymaokresin tdaekfainuglt aniyn Failure 0 t 0 o necessary steps in the presentation thereof any other
138 JUSTICES. Jiistices Acts . Amendment Act. 13 GEO. VI. No. 30, party may apply to a Judge in Chambers by summons served on such appellant for an order discharging the notice of appeal and the Judge shall make such order as shall be just with regard to the subject- matter of the application and to costs. ( 2. ) If the appellant fails to appear on the day on which the appeal is to be heard the Judge may upon proof of notice of the hearing having been given to both parties estreat the recognizance entered into by the appellant or order the forfeiture of the deposit lodged by way of security in lieu of such recognizance and order , the appellant to pay to the other party such costs as he may think just. JMdtdiueuoetdmnmegr. eomor' fsainna _ . pRJeuetdgtgiys [ e 2 tsr 3 aea 0 snrs . d ] iosUnshusapclaohlnmfmoetremhtmheoworradiatnenhtddeurusmmemniodnofartttahiooecntodhpeoeytferptmahrnoeirnpeeaaortpfipoccnele_ earorltfkifttihheodeef as correct by the said clerk of petty sessions shall be sufficient evidence of such determination for all purposes. Eofndfeocricseimone.nt Judg [ e 23 b 1 y . ] h(i1s. ) orIdferupcoonnftirhmes hveaarriiensginocfreta.hsees aoprpreeadl utchees the conviction order sentence or adjudication appealed against such conviction order sentence or adjudication may be enforced ( subject to any variation increase or reduction made therein) by any justices or justice as if no appeal had been brought unless the judge by his order gives any direction as to the enforcement of such conviction order sentence or adjudication. aCpopstesalo. f ( 2. ) If the appellant has entered into a recognizance the Judge may if he thinks fit direct that such recogniz ance be put in suit or if the appellant has made a deposit by way of security in lieu of such recognizance the Judge may direct that the money so deposited be applied so far as it will extend in payment of any moneys the appellant is required to pay on the enforcement of the said conviction order or adjudication and the residue if any of the amount so deposited be repaid to the a ppellant. [ 232. ] ( 1. ) If upon any appeal the Judge orders either party to pay costs such order shall direct such costs to be paid to the Registrar to be by him paid over to the party entitled to the same and shall state within what time such costs are to be paid.
1949. JUSTICES. Justices Acts Amendment - Act. 139 elass. iuhnnmcatdiihlttlo(elc2edngod) . rspatthtnIasofeythmsRsatuuoveeccneghhttihnscoteocrofotaspsartbtassefrueetaponyeroreopnsfoaontfitodhwat. aeponppaysalpyhipdipinlelilgicwrnasigoattisnhocinaneonrnotdtfihfhietscihiasxtetiebmppeeatehnhratscalyoetf stjtuahhmseetirepc( ea3ecm, y. ) otmgahUnneeninpzpetoarannoycafmespc( eroiionfssdttashuonecfayrtws) eiouiainnncrbhdseeoucfdfoiotsrbteossyurpcmijrhnuoasbvytcoiidebctreehetdsieofnoficfrfoas o rutbreccyehendtpmfouoinortctdatiiennnhsygge. Divi8ion III. - General provisions. Habeas Corpits and Certiorari. osftswruhuroameprmamprm [ aoJ, 2 nracu 3 tatrud 3 iynnsg . td ] ogeofjNdutttyhrhochieoeseprmdbeepiywormcrsftoao,1i. rrstoneoremnaancb, senuron h ttounto a unr b hgl e ooaeh a offsv s rtseaab c on o snertu r yyefh p o cceh u rerd J e. i s U vejptf S seuhtehads1c. era0tttleirSylcseueobasrpieesn, roxteednoeemrirrarrsCeobecJs, rohlstCemn, aeoirdengaugnreoitdndaaf, s c.C . o.on.nvt: r10o. . tlr! o Y oenfrs, sufficient notice of the intention to apply for such discharge. Such notice shall require them to transmit cwooranscvfaiocuutsineodnteodo,rbteoogrtedrtaehrne, srmiwfiittathendyth, etoodnetphwoehsiiCtciohountrshtaenocdrocmJoummdigptelmaietnhntet, cifonavniyct, ioinntoernodreddert, oorbceertriefileieddcoopniesinthesurepopfo. rt of s110h aaapnnpddet [ adh 2 ree 3 sp 4 oot . f ] sofietInhifocanevasenc, hyboarersegucnecedhretosicrtfoiaiennbdvtlieisccnhotdeipodeinde, sta, oonradbroeetrchdshoeearrj, tugrceadodngmsmtmhpeeilntartteienbodtyf, , Amendment. otwhfaerf o rarjnumtsetoidcn, elasyn, dtohtrehrmeeudispetofaenkcetsstoonrotheraravofefresctabipenpegneathrientosubsbuebsdtsaetfnaentcicatesl omrerJitusdgoef tshhealpl raolcloeewditnhges wbeafr o rraentthoef jcuosmticmesit, mthenetC, oaunrdt ammaeynadleldowinthaell cnoencveiscstairoyn poarrtoircduelarraslsino, atcocobredafnorctehwwiitthh rtehme afnacdtesd, atondhitshfe o rpmeresroncucsotomdmy. itted shall thereupon be prece [ d 2 i 3 n 5 g . ] seTchteionlsikme enptrioocneeeddinshgasll abse ihnadthaendlatshte tliwkoe c I e n rt . io a r s a e r s i _ o . f amendments may and shall be allowed to be made in
140 JUSTICES. Jiistices Acts Amendment Act. 13 GEO. VI. No. 30, Ndwiiostpthie.ciell! ed bJaPCaudooimudwl. rgeitetrotttrooo rJeusdpgeect boyf wevreitryofor c d e e r r tio b r r a o r u i, ghatndbefaofrteer tahme eCnodumrtenotr ina . any such case the order may be enforced in the proper manner, and shall in all respects and for all purposes be regarded and dealt with as if it had been drawn up originally as amended. c e o it r h p e u [ r s 23 bo 6 re . f ] o ce rT r eh ti e o o r r a n r oa i tfit : ceerPhtrehorveeibdiysesdupetrheosacftriwtbhheedenwmrcaiotypioebfse h og a fi b vt e he a ne s conviction or order and depositions are produced at the time of applying for the writ, the Court or Judge may dispense with such notice. [ 237. ] When any person committed to gaol by virtue ooff a ha s b u e m as m c a o r rp y u c s o , navnicdtitohne oCroourrdterorisJburdoguegphotsutppobnyeswtrhiet final decision of the case, such Court or Judge may discharge the person upon his recognizance with or without sureties for his appearance at such time and place, and upon such conditions, as the Court or Judge may appoint. If the judgment of the Court or Judge is against raenmya· npdershoinm stoo bhriosufgohrtmeurp, cutshteodCyo, utrhteroer toJusdegrve emtahye rest of the term for which he was committed. Amendment-1nformalities. taRtoihmfoe" ecnseopsnn, edvc& mticicne . ngt tbohfeeytohdn [ e 2 edj 3 pu 8 ost . sth ] iitecWieoscnh, osemtnhiepenvlnaesirinufttbsh, suetcaahfnnadcacetdsijfsuoudrspiucpecavohtiridtoefnnatchcdteeoseaaspodrnpjeoueatdvrieiicnxdagteteninbocynde would have justified the justices in making any necessary allegation or finding omitted in such adjudication, or in the formal conviction or order, or any warrant issued in pursuance of such adjudication, the powers of amend ment conferred by the foregoing provisions of this Part of this Act may be exercised, and when in a conviction there is some excess which may ( consistently with the merits of the case) be corrected, the conviction shall be amended accordingly, and shall stand good for the· remainder ; and all amendments shall be subject to such order as to costs and otherwise as the Court or Judge thinks fit. csWuommanpmtlaoo. nifnst.or ahnavoe [ r 2 bd 3 ee 9 ern . ] hcWaosnhdebenemetnnheemdpaoedrresdo, inroerccotanendvyitcotpebdeer, soosronladwgaahsionfssoetrfwgeiohtooedmds,
1949. JUSTICES. Jitstices Acts Amendment Act. 141 was present at the hearing of the case, the conviction or order shall be sustained, although there may have been no complaint or summons or amendment thereof, unless he objected at the hearing that there was no complaint or summons or amendment thereof. the w [ 2 a 4 n 0 t . ] ofNaonycodnivstircitbiountioonr, oorrdfeorrsahawllrobnegddeifsetaritbeudtifoonr oDfipsternibaulttyio. n of the penalty or forfeiture. sabupemepnem [ am 2 la 4 sra 1 iadl . y ] gea I boi f nyfsatjaunnssuytocifchfeepsnceocorensnovontirchteaiwogbnharieonoarscthhoawrosdfheoarbmaestenaandtnuittocoroirdnsyevmridcauhtdteaydes : aA.pbprse s c1toten: , dnd. ting to appear upon oath to any justice that such person- (i.) Is under a recognizance to appear on the hearing of the appeal and to abide the decision of the Court or a ,Judge thereon ; and (ii.) Is about to leave, or has left, Queensland, such justice may issue his warrant for the apprehension of such person and upon such person being brought before him may either release him on a recognizance with a surety or sureties sufficient in the opinion of such justice to secure the appearance of the appellant to abide the decision of the said Court or Judge or commit him wtoougaldolo i t f hseurwchisejubsteicdeefiesastaetdi. s"fied that the ends of justice r.:= - Princ3ip5a.l SAeccttioins rtewpoealheudndanredd thanedfoflilfotwyi-nthgreseectoifonthies: R : n- e 2g5e; a. w . 1 of inserted in lieu thereof, namely :- " [ 253. ] When an order to review a conviction, or No ! - 'ction omradienrtaoinr awblaerraagnatinhstasthbeejeunstgicreasntoerdjunsoticaectbiyonwhshoamll tbhee ord! 31' toaft e r icsosnuvedictinionre, soprecotrdoefranory wpraorcreaendtining tqaukeesntiounndwearsomr madaettoerrg.r' : a:n.t'e:de n . arising out of such conviction, or order or warrant. " Princ3ip6a.l SAeccttiiosnreptweaoledh. undred and sixty-one of the s R . e2p6e 1 a . l of .::t; ;_te 3 7 . In the head note to Part XI. of the Principal Am e ndment Act the words " AND RULES " are inserted after the .. word " FEES " .
142 JUS'ii! CES. .Justices Acts Amendment Act. 13 GEo. VI. No. 30 T N ew s. 267. a.nd· s3ix8t.yT- sheveefno, lliosw_ aidndgedsecatfitoenr , sencutmiobnetr_ wedo thwuondhruedndarnedd sixty-six of the Principal Act, namely : - RCouulrest. of " [ 267. ] The Governor in Council with the concurrence of a majority of the Judges of the Supreme Court may from time to time by Order in Council make Rules of Court providing for all or any purposes, whether general or to meet particular cases, that may be convenient for the administration of this Act or that may be necessary or expedient to carry out the objects and purposes of this Act, and whether in amendment to or modification of or addition to this Act, and where there may be in this Act no provision or no sufficient provision in respect of any matter or thing adequate, necessary, or expedient to give effect to this Act, providing for and supplying such omission or insufficiency. t" a R n a d tif T ic h a e tiT p on r h o ) e v A i S si cu o tp n o s rfe o m f1 e * 9"2 C 8 To " huer s tS h u a Ap ll rcets a m p e p AC ly moue a nr n tdA d mce e tn x otf te1 ( n R 9d2 u 1 l i e n" s respect of such Rules of Court. Every such Rule of Court shall be laid before the Legislative Assembly within forty days after the making thereof, if the Legislative Assembly is then sitting, or, if the Legislative Assembly is not then sitting. within forty days after the commencement of the next ensuing session. If the Legislative Assembly, by resolution passed within one month after such Rule has been so laid before it, resolves that the whole or any part of such Rule ought not to continue in force, the same shall, after the date of such resolution, cease to be of any force, without prejudice nevertheless to the making of any other Rule in its place or to anything done in pursuance of such Rule before the date of such resolution. But subject as aforesaid, every such Rule of Court pafutreproprutibnlgicatotiobne inmathdee G in az p et u te r , subaendceeemofedthtios hAacvte sbheaelln, duly made and to have been within the powers of this Act. " t * 1129 GG. . 55 NNoo.. 315. .
JUSTICES. 143 1 949; Justices Acts Amendment Act. Repeal and Saving. A Ac c t t s, a 4 r13 0 e89 . r8e. 6TpThe to aehlee1pdA9r4otc9ov" tistshi( omeanseesnxitnotiefsonenPrtetaidenrdtsinubIcXyhth. tSehocifhsSec*Ahd" euc T dtl) eu h , li e enshd J tai u coll s a t tt i neh c od e ist s . R . SS : caehvf : eiend ! .gu I . l e o e n f . te. apply to any decision made before this Act comes into force and the provisions of Part IX. of the Principal Act as existing prior to the repeal thereof by this Act shall conturne in force so far as relates to any such decision. oittwnaaSpPnhepftoelrimaestpmitncsrhtthopieehhiciNoiinosonisenenparfeAtrsaaistempbStuirlacshoayciepctnAlnsheynhesdtorsecctihfdnsdtaotoituidgssfrivmhasliApeteasnecoartllpldcafyirdetpcticrr. eoct, teotektshhpsinbssniteeorfeshftooaefrmosisrlfAosrutprehhpebcteonAoehtecsftaltttecdsrnitiotetvispymdfnupeeusgctelapssrhyitaeduopeCi, alsonreboolsosnolssiuboofiroersenpnsfatttfpsrssiwonopnrerfoyetejargeuofjnoCtAudaavPtodybtinctiuecshite- dtrceittetotehmwysosneoauooresoSrfbnrpfoeitsotarnsaoPaiifesssoffestisffnloatteaiieinnehetnccicydduggttest AitaattpnhownsecseryotebcsrroeleodaWtetnfeisraosdkitpttaihrafhppsioescoorsfotuPiaumnvftpcortoiihaersenrftdideupcotaemriylnpupatsephanac. snenoeldetriAdseiansorstocinsomtrtuaenhafdbesoeosnstritisphiesnnhsterhsaaiornetailvedrlgdaitrspemcsiabodphotsennoabetilstonnlyihnfotbetummfehheseapiiasesndatncAtoseatdsipciouwhnbptnno, hegodlaaitddnenotwerstfdeooemsmneftaufevthincencyeihydetsr --- ---- Year and Number of Act. -- - S - CHED -- UL - E - . - - -- - c- - - ----- sS. ch3e9d. ule. Short Title. Extent of Repeal. 11 Vic. No. 41 36 Vic. No. 2 56 Vic. No. 23 " The Oour' ts ofPetty Sessions Act of The whole. 1848 " " The Clerks of Petty Sessions Act of The whole. " T 18 h 7 e 2 J " ustices Act Amendment Act The whole. of 1892 " * 50 V. No. 17 and amending Acts.